PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr041525.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 329aa    MW: 36805 Da    PI: 6.8562
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr041525.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed+ l +++k++G g+W+  +++ g++R++k+c++rw++yl
      Pbr041525.1 14 RGAWTAHEDKVLTEYIKLHGEGRWRNLPKKAGLNRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding53.17.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
      Pbr041525.1  67 RGNISPDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.556961IPR017930Myb domain
SuperFamilySSF466898.61E-2912108IPR009057Homeodomain-like
SMARTSM007171.4E-131363IPR001005SANT/Myb domain
PfamPF002494.6E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-231568IPR009057Homeodomain-like
CDDcd001671.91E-101661No hitNo description
PROSITE profilePS5129425.4262116IPR017930Myb domain
SMARTSM007175.3E-1666114IPR001005SANT/Myb domain
PfamPF002494.5E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2469116IPR009057Homeodomain-like
CDDcd001672.03E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRSPCCAKE GMNRGAWTAH EDKVLTEYIK LHGEGRWRNL PKKAGLNRCG KSCRLRWLNY  60
LRPDIKRGNI SPDEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLGKKVHDHQ  120
QGSASDLKHH KNGEPNSKKA KMMDMAAPAS HVVRTKAAKC TKVFIDPHPH KVPLGHDHQH  180
CTEETNAGGL MFGDKPAAVD DDHINSTQSF SSFSNINADQ ENATSDFLAD FAMDEISLAN  240
LLNSDFPEIN HDELNHNGSD NGMSHCVDET ARFFSEGMLQ HWKNGGSDDG DDRVQVQPNL  300
VLNFHSYTSF LGSDHQGKNA LELERVVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009361685.10.0PREDICTED: LOW QUALITY PROTEIN: transcription factor TT2
SwissprotQ9FJA23e-63TT2_ARATH; Transcription factor TT2
TrEMBLM5WG391e-157M5WG39_PRUPE; Uncharacterized protein
STRINGGLYMA13G16890.11e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.12e-64MYB family protein